PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_19.62
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family bZIP
Protein Properties Length: 378aa    MW: 41556.9 Da    PI: 6.0211
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_19.62genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.31.1e-10171223557
                                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                                  kr++r + NR +A rs +RK  +i eLe+kv++L++e ++L  +l   +    
  evm.model.supercontig_19.62 171 KRAKRIIANRQSAARSKERKARYISELERKVQTLQTEATTLSAQLTLFQRDTT 223
                                  9****************************************999877666555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.7E-17167231IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.622169232IPR004827Basic-leucine zipper domain
PfamPF001702.8E-9171220IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.03E-11171222No hitNo description
Gene3DG3DSA:1.20.5.1709.2E-11171225No hitNo description
CDDcd147031.21E-23172221No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MDMEDPNPKG NQNPNPNPAL QYQSTAHHHP QSSATSFANP AVPFRGSYHR RAQSEVQFRI  60
PDDLDLASDP FGSFEELGSE DDLFCTYMDI EKFGSRPDDG AGSSAPKSEN VEGLDNGGGD  120
GGGREKNVDE NVRSRHRHSN SLDGSSILES IEAKKAMAPD KLAELWNVDP KRAKRIIANR  180
QSAARSKERK ARYISELERK VQTLQTEATT LSAQLTLFQR DTTGLTTENT ELKLRLQAME  240
QQAQLRDALN EALKKEVERL KVATGEMMTP ADTYNLGMHQ IPYSQSSFFA SPPQPGQADA  300
QNMQMPQFHP FQSHLSAPNI ANPHHPLLSN AHAHTFSEML QQDPLGRLQG LDISSRGSHL  360
VKAEGPSISA SESSSTF*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00303DAPTransfer from AT2G40620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015877571.11e-179PREDICTED: transcription factor RF2b
SwissprotQ6S4P41e-104RF2B_ORYSJ; Transcription factor RF2b
TrEMBLM5XK211e-173M5XK21_PRUPE; Uncharacterized protein
STRINGVIT_13s0067g02900.t011e-167(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40422757
Representative plantOGRP12617181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.11e-125bZIP family protein